PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000144203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 726aa    MW: 79722.9 Da    PI: 6.5128
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000144203genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.37.5e-29237293359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES-.-SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege.Hnhe 59 
                     gynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  d++++ei+Y+g  Hnh 
  MDP0000144203 237 HGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSY-DGQITEIIYKGApHNHA 293
                    69**************************************.**********9669997 PP

2WRKY103.31.3e-32463521159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k+v++ Yeg+Hnhe
  MDP0000144203 463 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERASHDLKFVITAYEGKHNHE 521
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-24227295IPR003657WRKY domain
PROSITE profilePS5081122.779230295IPR003657WRKY domain
SuperFamilySSF1182909.55E-22234295IPR003657WRKY domain
SMARTSM007743.3E-29235294IPR003657WRKY domain
PfamPF031066.2E-21238292IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-35448523IPR003657WRKY domain
SuperFamilySSF1182909.15E-28456523IPR003657WRKY domain
PROSITE profilePS5081137.516458523IPR003657WRKY domain
SMARTSM007741.2E-36463522IPR003657WRKY domain
PfamPF031069.3E-25464521IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MEQEDDAVTE SKADGGGGGG GSGGAGSGXS IAERRAAKCG FNAERINTVR VXTTNPLNSP  60
XARSPCLTIP SGISPTALLD SPVMVPNSQA LPSPTTGTFP LRPPNDNSLL LKSGTREDDG  120
YRPAYSSFEN QGSTVDYQAL VLEQQPMEFQ FPMEFSKEAN ATDYAVDPST DVRNINSGVI  180
MNANSADLQM SHSSAASDQX SLPKEAXHGE DMGTHQFSEG EHKGSYSSAG MVRTSEHGYN  240
WRKYGQKQVK GSEYPRSYYK CTHPNCQVKK KVERSYDGQI TEIIYKGAPH NHAKPQPNRR  300
AGASVGPSFS YDDMSEMGEG SRAAVKVEGG PVWTDIQSCK DRKVGYDGRP DGLERTSSAS  360
VVTELSDPFS TTQGKSMNIF ESAETPELSS TLASHDDDDR ATQGSISLGD DADDEESDSK  420
RRQVNFCLSQ RKKESCMIET NFASRDVRKP RVVVQIESEI DILDDGYRWR KYGQKVVKGN  480
PNPRSYYKCT SAGCSVRKHV ERASHDLKFV ITAYEGKHNH EVPAARNSNH MNSSSGNGLP  540
STANAQPALA LPRNTNIPKP ETQVQDLAPH FDRKXXFHDK YMRTSFLGNF SNDMKFGAPS  600
LYQMKYPPPQ NTMLYASFGM HANHNVAHQA GSVVPDFPIS LPMSLPPSGN LPLASYXFNN  660
GKSVCPEQPY FSRQQLQEID VRFLQPKQEX KDDNXYDAXF PTMDXSSAAL SSXSLFYHRV  720
MGGYPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-34224524178Probable WRKY transcription factor 4
2lex_A9e-34224524178Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370928.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLM5WG220.0M5WG22_PRUPE; Uncharacterized protein (Fragment)
STRINGGLYMA09G38581.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-102WRKY DNA-binding protein 2